DPCstruct | MC47686
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 82 ± 13 aa |
| Standard deviation of domain lengths | 13.13 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 92.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02073 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0T1Q6 | 8-82 | EFAFGTNFDITRFTKNILFDEKIGGTVHMAVGLGYPETGSRNKSAIHWDMIADLRQGGVATVDGEPFLKDGGFVV |
| A0A538KA87 | 127-209 | RDEGARVLGELGIGCNTGIQRYMRNTLFDEKIDGTVHLAIGAGFPALGGKNESVVHWDMVKDLRPGGQLLCDGEVVQENGRWL |
| A0A2M8NQI8 | 32-110 | None |
| A0A7X6YPZ4 | 591-686 | None |
| A0A0A2TJ83 | 235-330 | None |
| A0A1V5USP8 | 571-642 | None |
| A0A538GI91 | 1-62 | None |
| A0A7Y5KFX6 | 133-199 | None |
| A0A2E7S4Z4 | 2-101 | None |
| A0A7K4BYQ3 | 273-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.