DPCstruct | MC47685
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 73 ± 11 aa |
| Standard deviation of domain lengths | 10.93 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R9BAD5 | 5-64 | VEPVLEDLASGQWGLFTAAQARVRRVSRANLSHRERDGRLVRLAHGVYRLGGVPVAPLDE |
| A0A7W0T161 | 1-90 | MPNHPDTVDLFQIAAGQQGYFTSRQAHDAGVSNDLVKHYLRSGKFIRAHRGVYRFRDYPPSPREHVVAAWLAVGRITPLFPTRAGWT… |
| A0A7I9V0L2 | 9-82 | None |
| A0A7V9GF52 | 7-80 | None |
| A0A7C5URC5 | 1-62 | None |
| A0A413DTI4 | 1-63 | None |
| A0A6N7FVY4 | 10-69 | None |
| A0A7S7M8Z0 | 5-72 | None |
| A0A6N9YMT9 | 1-78 | None |
| A0A2W1XA02 | 5-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.