DPCstruct | MC4768
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 108 ± 7 aa |
| Standard deviation of domain lengths | 6.96 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 29.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X0ICR9 | 73-179 | GISSVYATPTGGVPAKYLGLAQGNGTTLVRDPTSVASNPFWHDVSTLPGYPGGVTDVSLTVPPVTPNQLHITVRSITGKVAQATCLL… |
| A0A3N1CT39 | 94-199 | IGIDSAFHGELLFVGVVTEDGSTFIRDQRDLMDPPTWHDLSTLDDYPVGQAVDVTLADHGDNVHVSVLTAAGKVFTTACKVNPDPEP… |
| A0A1N7E2W0 | 1-104 | None |
| A0A7C9NIY7 | 254-359 | None |
| A0A1H7WFQ4 | 127-220 | None |
| A0A7X0ICZ3 | 149-268 | None |
| A0A1I2YAQ5 | 113-227 | None |
| A0A429B1M6 | 8-119 | None |
| A0A7H8IKW7 | 9-124 | None |
| A0A5R8Z2D8 | 64-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.