DPCstruct | MC47675
Metacluster Properties and Pfam Annotations
| Number of structural domains | 285 |
|---|---|
| Mean domain length (aa) | 176 ± 33 aa |
| Standard deviation of domain lengths | 33.47 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.84 |
| Pfam Score | 99.23 |
| Assigned Pfam label(s) | CL0237- CL0318 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D0IKU5 | 2-163 | LEKTKDYAIKKHKDVNQKYGDYDYDFHLNMVYETAQKFIHIIAPEERENVLAACWVHDVIEDARETYNDVKNVTNTTIAELAYALTN… |
| A0A0L0LHN8 | 6-178 | SSLLDRATRMAVDGHAIQVRKDDNSPYIVHPVMVAILLAQHGFSETVIAAGLTHDLVEDTEYTIDQIREELGDEVATIVASVTNQEG… |
| A0A4V0X3X3 | 20-207 | None |
| A0A1V5IL88 | 40-231 | None |
| A0A1H6EQW4 | 24-191 | None |
| A0A2Z4FIE0 | 5-186 | None |
| A0A261DD08 | 1-165 | None |
| A0A6C1NUW7 | 9-154 | None |
| A0A7G7HWC8 | 3-142 | None |
| A0A1Q6K549 | 3-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.