DPCstruct | MC47669
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 764 ± 128 aa |
| Standard deviation of domain lengths | 128.12 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.17 |
| Pfam Score | 91.07 |
| Assigned Pfam label(s) | PF01915- CL0036- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847PKA8 | 98-845 | KDPIDFYEALDNAGIEYNKELFRRYKAWADLNAGKHTGNGFIDMLTPMIRGSVMKELPISTITSRVMKRAQKFSDTAIIVIGRGGSE… |
| A0A7C6NZ62 | 194-879 | YTIDLVEAVRESKDFTLNEELVQFYHCDEDRIPDRMALDRAKEKSDTALMVITRGTGENMDNSTAKGEYYLSDQEEALLQTLTKEFK… |
| A0A1Y4TK81 | 137-707 | None |
| A0A806JZZ4 | 2-613 | None |
| F0Z0G5 | 10-1122 | None |
| A0A355V1D9 | 118-983 | None |
| A0A7X5R6Y7 | 70-790 | None |
| A0A7C6CX64 | 209-1100 | None |
| A0A4S2HIT5 | 8-734 | None |
| A0A847B4J8 | 3-883 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.