DPCstruct | MC47667
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 253 ± 34 aa |
| Standard deviation of domain lengths | 34.37 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 94.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00374 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A658YXR1 | 21-273 | NLMGFAHYLEALDFQREIVKIHAVFGGKNPHPNWIVGGMPCAINIDESGAVGAVNMERLNLVQSIITRTADFINNVMIPDALAIGQF… |
| A0A447PAT6 | 112-377 | NLMGFAHYLEALDFQREIVKIHTIFGGKNPHPNWIVGGMPCAINLDQSGAVGAINMERLNLVQSIITRTADFINNVMVPDALAIGQF… |
| A0A7C4JPW7 | 58-325 | None |
| A0A011PYP0 | 1-195 | None |
| A0A7V3CRK3 | 187-401 | None |
| A0A1G6CA24 | 106-344 | None |
| A0A1W1WVN2 | 185-462 | None |
| A0A7I7LKV9 | 181-477 | None |
| A0A377DVS7 | 2-266 | None |
| A0A101G1N1 | 180-437 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.