DPCstruct | MC47665
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 120 ± 14 aa |
| Standard deviation of domain lengths | 14.39 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9WGT7 | 31-128 | ELPHYEVFYPTKTQYLVWKAGFPTYQLTDADGYKYIVQGYKVETSELDTLGDQFQELPYGWSYNVVTPDEDIVFDLTPDVPIPSVPD… |
| A0A391NKI9 | 91-185 | SPYTDFTLRWESVHVYNSGRRVYELESPLGDTYRMVSYCLLVDSELDVETLSTLGVGLSLPEGWSYSTRTLGQEEALDSHTVVRLQD… |
| A0A845X8Y9 | 197-316 | None |
| A0A7S4MK93 | 1-130 | None |
| A0A3R6YA14 | 38-147 | None |
| A0A559UXT8 | 6-102 | None |
| A0A2E3NM58 | 100-230 | None |
| A0Z9E0 | 44-165 | None |
| A0A654U4C0 | 9-131 | None |
| A0A354K1Y4 | 1-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.