DPCstruct | MC47661
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 102 ± 6 aa |
| Standard deviation of domain lengths | 5.90 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9W5F6 | 10-100 | CGCIEQMPVVTNAACTKVEATQMVYVTYTAATTSFSATVDITSISHSDCGDLSAYYDSLVAEGKATEREKALLDEHLVGSCDAAIGS… |
| A0A7S1FWG6 | 354-463 | NCIEDMPVVSRADCTQVDVNQDFTVTYSNGEFSVTKTGDMNVKFNSCQGINPSNGRRTNNDLGSYVYRLNKEGKISDETMEGVFDTL… |
| K0TMT5 | 1-100 | None |
| A0A7S3VDC8 | 273-372 | None |
| K0REE3 | 331-431 | None |
| A0A7S4QS03 | 1-108 | None |
| A0A7S2E4B1 | 20-124 | None |
| A0A7S2HWN5 | 634-743 | None |
| A0A6T9Y978 | 111-216 | None |
| A0A7S1V5J6 | 353-447 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.