DPCstruct | MC47653
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 251 ± 56 aa |
| Standard deviation of domain lengths | 55.75 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 90.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 21.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z9ZGV4 | 277-475 | GGWQLDLPLEVQPESEWGTLPRFRQAAEEFARERGYRFVVLRGDSPEHYAELAFRAHRLLSEKEGRPPQGVLVDCFTQLNPEANRLS… |
| A0A6N9YCH6 | 18-292 | TLPKAYARFLADRLEPAAPVLLLHDARTWPVRDCGDGHSFQAGSPAGGLDPVDFHPDARALGQVLRAVGGEETRWEAPEVTVAGAFA… |
| A0A7V6UXT8 | 861-1218 | None |
| A0A1V6SPS0 | 622-870 | None |
| A0A1V6P5K4 | 311-546 | None |
| A0A645DN07 | 126-344 | None |
| A0A560AQM5 | 401-621 | None |
| A0A641W5L5 | 4-333 | None |
| A0A524DUM3 | 13-259 | None |
| A0A810NA02 | 2-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.