DPCstruct | MC47652
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 70 ± 6 aa |
| Standard deviation of domain lengths | 6.38 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 45.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0254 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N9YB23 | 2-66 | GIIGTAIGLALRGYRPVCEIQFDGFVFPAADQIITQLAKMRMRSLGKLSLPVVVRIPCGGGIGAV |
| A0A3B3YYU2 | 79-149 | DTPISEMGFAGIAVGAAMAGLRPICEFMTFNFSMQAIDQVINSAAKTYYMSAGLQPVPIVFRGPNGASAGV |
| A0A287TFL1 | 15-80 | None |
| A0A553P0Q7 | 917-983 | None |
| M9LXL2 | 674-744 | None |
| A0A819RHT0 | 556-625 | None |
| A0A542IDF1 | 73-151 | None |
| A0A2W1BKE9 | 227-293 | None |
| A0A814THS1 | 113-182 | None |
| A0A268HX54 | 12-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.