DPCstruct | MC47651
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 66 ± 3 aa |
| Standard deviation of domain lengths | 3.41 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 93.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 38.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N9Y877 | 1-66 | RGFDKRVWQVESAGPAELLLRLVSPDGEEGYPGELTARVRYVLDGDTLRLEYRVTTDAPTVVNLTN |
| A0A7F5R7Q1 | 51-116 | RGFNKVVWDYYVKGTKVVFSYASSDGEEGYPGNVVTNVTFQLSDENELVIDYKASTTKPTLVNLTN |
| A0A287W0X8 | 1-74 | None |
| A0A068VE09 | 67-130 | None |
| A0A7R9EHG4 | 52-116 | None |
| A0A6A2XIF5 | 64-132 | None |
| A0A4U5MPV4 | 7-71 | None |
| A0A402EHM7 | 1-60 | None |
| X6NAL1 | 229-295 | None |
| A0A6A2ZVG3 | 81-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.