DPCstruct | MC4765
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 528 ± 26 aa |
| Standard deviation of domain lengths | 26.02 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 81.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 17.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R1TKE7 | 1-560 | MLTTDKFIRSYTPFFEANAVPFQFAQVLKNSLVVLDEFDSTKERLLEKSIDDALKVKVDLLNLFKAIYRNLHKIADLPSELQEIMTE… |
| A0A0D1ENN9 | 201-685 | LTTSKLLYPWHSIDKSYRISDFLDNSLLILDEFDRQQSEFLAHLINTVSDYDIIALTRKFYSSFDSFKIHGSPEFNGVDKCFDRFRN… |
| A0A7T3X2F1 | 68-575 | None |
| A0A3E0GZX3 | 235-758 | None |
| A0A1V5P115 | 1-493 | None |
| A0A8B4PE37 | 179-718 | None |
| E7T5A4 | 116-620 | None |
| A0A4Q5LR22 | 214-747 | None |
| A0A4Q7DWD0 | 233-779 | None |
| A0A1B2IWT0 | 2-519 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.