DPCstruct | MC47649
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 92 ± 8 aa |
| Standard deviation of domain lengths | 7.99 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 93.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 38.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3QLL1 | 213-298 | VERILRHPHTAIASDGGVREFGVGMPHPRSYGTNARVLAEYVRRRKAITLEDAIRRMTSLPARTFAFRDRGLVREGMAADLVIFDP |
| A0A6N9Y7T8 | 1-85 | SVRALLRHPAQMAGSDAIYQGGHPHPRGWGAFARLLGRHVRELGDWTWEQAAVHLAGRAAERFRLHDRGRIEAGRAADLVVLDPA |
| A2DAF2 | 69-162 | None |
| A0A2H5W2Y9 | 328-413 | None |
| A0A3T1DN40 | 1-103 | None |
| A0A0Q8RGS7 | 115-223 | None |
| A0A7C5N632 | 286-375 | None |
| L9VFX1 | 71-162 | None |
| A0A354VNJ9 | 209-294 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.