DPCstruct | MC47646
Metacluster Properties and Pfam Annotations
| Number of structural domains | 88 |
|---|---|
| Mean domain length (aa) | 118 ± 13 aa |
| Standard deviation of domain lengths | 13.45 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A9SXV3 | 9-126 | IQDNLVIIKINQSYRVGMTALELYDVTRGSWKRKIDSVKDAEYALAVSDSKVVEVYRIEEWLPSEEVIRETIPYDPEKVAGRITFNG… |
| A0A4V0IAM0 | 2-133 | QISKNKINATGLILVVKIKNALELSKNDSLNFTLQNFDDTNLKSRTLGNWILAKEKADKIQYIIGVNTGGENLVVSAYKVTRYERFQ… |
| A0A5N6BZP1 | 2-123 | None |
| A0A4S3PLA0 | 4-115 | None |
| A0A0A0BVV0 | 132-251 | None |
| A0A075UJV2 | 2-116 | None |
| K9Z7K4 | 405-515 | None |
| A0A3N2KWD6 | 33-170 | None |
| A0A3A8HTA7 | 11-142 | None |
| A0A5D4KVZ0 | 21-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.