DPCstruct | MC47645
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 557 ± 82 aa |
| Standard deviation of domain lengths | 82.30 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 30.19 |
| Pfam Score | 90.57 |
| Assigned Pfam label(s) | CL0014- PF02769 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A9STN1 | 664-1267 | DLNVCSQKGLVEMFDSSIGAGSVLMPYGGKYQLTETQTMIAKLPVLAGKTDTVTMMSYGFDPFLSSWSPYHGAAYAVTESVARIVAS… |
| A0A3M5WQ69 | 2-429 | IQGLNSDGHILSYHDRSDGGLLVSTLEMAFAGHCGLNLHLDGVADNVSELSAILFNEELGAVIQVRQDATPLVLAQFSAAGLEDCVA… |
| A0A146H7V5 | 135-767 | None |
| A0A7W4EXP7 | 178-796 | None |
| A0A1I8IN14 | 167-842 | None |
| A0A5S6QT58 | 13-587 | None |
| A0A834T600 | 104-588 | None |
| A0A1A9UK57 | 46-726 | None |
| R5FIC9 | 224-757 | None |
| A0A8B6ETX4 | 1-555 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.