DPCstruct | MC47636
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 96 ± 11 aa |
| Standard deviation of domain lengths | 10.95 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5P8WBU9 | 109-210 | VAVQKSKGRQRKGCLYKYIENKKLKNGTIASYPRVIGHIQPDNPTHWRWGFNWEEKIDGEWKGRSIGSIPVGAIALIQSMQNEGVPL… |
| A0A1C0V389 | 373-455 | GCLYKYIEKKKFKDGSVIEYPRVEAGERDPDNPSHWRWGFNYEIKVNGKWKGRSIGSIPPDLILDIKLMQLDGASLEEIIKFI |
| A0A6P1AIT9 | 1-82 | None |
| A0A139WR24 | 461-559 | None |
| A0A3F3KKW3 | 90-183 | None |
| A0A1B7UYV3 | 6-93 | None |
| A0A139WR15 | 5-77 | None |
| A0A433VG48 | 352-437 | None |
| A0A6M0FRR7 | 19-115 | None |
| A0A7H0F5P6 | 277-371 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.