DPCstruct | MC4763
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 99 ± 8 aa |
| Standard deviation of domain lengths | 8.40 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0682 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R6GF79 | 119-208 | KAKITPSITAEDKDYDGNTAATVNVSFEGLQKDEKLVEGKDYTVSATFDDATAGENKTVTATITLKNTAKANNYKLSTDSVKTTAAI… |
| A0A3A8WHN2 | 1-112 | MTPKTVTPYIEGSISKIYDGSDSIDGAENTLSIRLEGIIEDENVSASGKIRYADSEIGKDKSIIAEDIGIIGEGKDNYILSSTTATA… |
| A0A1Y4GEA2 | 535-628 | None |
| A0A1Q7Z8Z6 | 65-173 | None |
| A0A3R6Q314 | 469-567 | None |
| A0A1B1I0T5 | 717-816 | None |
| A0A396QJ49 | 25-125 | None |
| A0A3A9IV02 | 862-951 | None |
| A0A1V5ISM9 | 984-1070 | None |
| A0A839K0N3 | 273-384 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.