DPCstruct | MC47628
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 127 ± 19 aa |
| Standard deviation of domain lengths | 18.54 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 20.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N2KVD3 | 1-119 | MRKRIAVIIFMTLGMLLSLNAIVTRDDAKAQILNQIMVNSIGKANIYLSTQTVAVGVNVVSHNETIITPYSSSWVTFIDDNPVFGWK… |
| A0A2V5R5G1 | 1-107 | MNVDQARAAILAAVPRSFERTAAAYIADRCFAPGDILSLDRQPFTVDREIHFGFIDLEAGRNWGHACKCVLCNCADDGIEIRPLSFP… |
| A0A0Q1B2V7 | 3-109 | None |
| A0A147JWL1 | 54-178 | None |
| A0A661AJP7 | 1-138 | None |
| A0A1D2QXJ2 | 17-137 | None |
| A0A1F5TMM6 | 23-166 | None |
| A0A5C5W4U3 | 40-163 | None |
| A0A350F316 | 1-126 | None |
| A0A2G6N5P9 | 27-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.