DPCstruct | MC47626
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 480 ± 67 aa |
| Standard deviation of domain lengths | 66.84 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 16.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A146IMP8 | 598-1148 | SACLDEVRSGKWGTEGALDNFGHPVANLSQATAVSYSLCVRACGSGSEPFSWNTFSQQFTAWLLPYLALVSQLPFGAKTRLDNLSSM… |
| A0A3N4L9Z0 | 76-536 | VSLTWCRAECGGFQPSRVSKNHLNEILSPLVGFLIPALVFSISIPRGWQLRIPERLFKEDWFTARGSMNLILAMVIVMVETLRWITV… |
| A0A0U4Z5A7 | 36-525 | None |
| A0A409WE37 | 117-586 | None |
| A0A1L7WHP4 | 8-378 | None |
| A0A6A5VWW2 | 33-632 | None |
| F8PUB5 | 1-412 | None |
| A0A4S8LV46 | 344-889 | None |
| C4JKE6 | 2-418 | None |
| A0A2V1DGA0 | 8-471 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.