DPCstruct | MC47625
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 306 ± 36 aa |
| Standard deviation of domain lengths | 36.18 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 68.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.17 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A146IHI7 | 1-275 | MHQPQQPAPASMASPSSSPGGPVFGKASKACSRCRHDKTWCNGALPSCSACTQKGVQCTEGCLGCRQARSPCVKTAGNARCTRCTEQ… |
| A0A0C9YG15 | 1-271 | MDSPPSPVPSSFPASDIVTATWPKRTAKACTSCRRDKIRCDGARPCAACLKKGYTIDQCTDGCESCRRARARCEGGKPCLRCRDMHL… |
| A0A2S7PSB7 | 268-531 | None |
| A0A5N5QLU7 | 1-323 | None |
| A0A1L7X0X9 | 324-572 | None |
| A0A1L7XGB1 | 287-625 | None |
| A0A074SFQ3 | 1-335 | None |
| A0A6A6VTD0 | 198-558 | None |
| K1Y2I9 | 111-441 | None |
| A0A166HYA6 | 1-311 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.