DPCstruct | MC47623
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 207 ± 34 aa |
| Standard deviation of domain lengths | 34.28 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 75.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 19.78 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | CL0110- CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A146IF08 | 22-262 | LWQISPAPVYVQFATHLNDERNLKKCILELLSKLPSPAAGSSSFGVLFSFFHCAIVERRADGGVRVAAPLQFLPSLYDINPSTPGIE… |
| A0A1B7MTL8 | 191-403 | KEFTWIREDTVLCIATHLDDERCLFASISRLIDEILAQKDNPGDYFGVAFSISHCAIVKVVKYTHAATFGHTGALQFLPSFFADSPS… |
| A0A4Y9Z493 | 111-342 | None |
| A0A1B7MYL7 | 59-284 | None |
| A0A093ZQ33 | 323-547 | None |
| A0A0D7B037 | 271-425 | None |
| B8NWT4 | 134-302 | None |
| A0A0F0IHK0 | 320-500 | None |
| A0A0B4GMP4 | 1-203 | None |
| A0A1B8FJV9 | 45-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.