DPCstruct | MC47616
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 98 ± 10 aa |
| Standard deviation of domain lengths | 9.74 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 47.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K8RDC8 | 1-97 | MATEGCKKLKYTIHKCSSYTGSYLPENNLVDKPADQYSRWSSDSNYPPQFLILKLERPAIVQSITFGKYEKTHVCNMKKFKIYGGLT… |
| A0A6S7IL88 | 1-113 | MAAMSDDFENFQNINVENMEHKLKYSVYSCSSFSANFHPGNIMEDKPNDQNSRWTSETHHPTQYITLKLEKPAAVTKITFGKYHQNH… |
| O13730 | 4-99 | None |
| A0A556THH0 | 10-97 | None |
| A0A0C3PL91 | 1-108 | None |
| A0A6J1THH5 | 3-99 | None |
| A0A1Y3NCK3 | 30-109 | None |
| A0A075ANW0 | 3-110 | None |
| A0A811W8N1 | 1-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.