DPCstruct | MC47615
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 108 ± 23 aa |
| Standard deviation of domain lengths | 23.42 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 82.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 44.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S7IJR1 | 9-91 | YHVPRFMKIHSGIRKFSGQGVEKLNDDCWRTHLEKSNKWDAAKDVLMAEERLGVLSELQRTPRTYKKKADKYWATGIMDSRKK |
| A0A6S7KH37 | 9-99 | TPYIHAMVYHVPKFMRIHNGIKKFIGQGVEKLNDDCRRVHLQRSNKWDAAKDVLLVGKRIEHLAECKRTPRSYKKQNSSYLETGIKD… |
| A0A1X7T8W8 | 112-199 | None |
| A0A7D9LII5 | 113-211 | None |
| A0A6S7HYL8 | 84-214 | None |
| A0A6S7HT56 | 73-155 | None |
| A0A7D9DEX9 | 109-216 | None |
| A0A7D9HIN9 | 177-266 | None |
| A0A7D9HH77 | 32-127 | None |
| A0A6S7K5L0 | 18-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.