DPCstruct | MC47612
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 507 ± 111 aa |
| Standard deviation of domain lengths | 111.18 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 80.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 20.99 |
| Pfam Score | 51.78 |
| Assigned Pfam label(s) | PF06119- PF01033- CL0159- CL0741- PF03782 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498NG59 | 72-544 | LGGRDFKILNATFEQNINLTCRFNSEILTEGYVDESGVGHCISPLLYESGWIPFEVSTDGVNYDRAGRWLSVHHSKLSPFYTIVMVN… |
| A0A0P5KZ35 | 120-707 | TVYTSQPLVFAPESGNMMGGMMVNVTGPCFNADRRIICRFDTQDVVGKYIDQNRAVCIMPRVYATGYVDLTISIDGGNFNWKGRFYV… |
| A0A817SEM9 | 715-1174 | None |
| A0A0B1PLA1 | 3-448 | None |
| A0A369RPH5 | 14-581 | None |
| A0A2C9KBW1 | 248-744 | None |
| A0A0K0DSX8 | 735-1279 | None |
| A0A6P8H7J5 | 42-674 | None |
| A0A6P8HGZ9 | 124-726 | None |
| A0A2L1TH26 | 378-931 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.