DPCstruct | MC47611
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 91 ± 8 aa |
| Standard deviation of domain lengths | 7.67 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M6UZ81 | 3-84 | ASCSFKFIVGSPCSYDRRDRSKLFVVVPLVSCNKDVQDHKSAWCFAGVENESELILARAGIFYMSAKDIKALTICPFHRSEL |
| A0A6J8EKX3 | 11-98 | TTHLCSLSHFSKTPCSLVSTSDNPSKLIYLKECKKSVSNHLRSLNISYDENILTEGLLICLRVGIFRLMPHFTVCPYHRSSLGLNWKR |
| A0A8B6E941 | 1-88 | None |
| A0A7D9HBR1 | 3-94 | None |
| A0A6J8C7E2 | 1-105 | None |
| K1QZ73 | 9-108 | None |
| A0A8B6GQE5 | 131-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.