DPCstruct | MC47610
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 169 ± 31 aa |
| Standard deviation of domain lengths | 30.85 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 70.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D9L3L2 | 335-576 | GLTGGIDKEVRSAHTRTRRPQEFTRSLELAKRYRLCVTSVDYRTEVNCRFVCKCHDDDIIVTIAQKPICLKNGDICKYTRNGTQVCS… |
| A0A6S7HCP9 | 45-225 | AVAYDEGKLNEVVRNYKPNISAIVQPSGKAGKNPNQSVRKRKSSTTKGKRSVAEFNDPLAHTDLINFPDPDNWTVVFVKNTKMRKCY… |
| A0A6S7FKX5 | 94-269 | None |
| A0A6S7FWP1 | 5-154 | None |
| A0A6S7G9P0 | 220-395 | None |
| A0A6S7GH53 | 55-219 | None |
| A0A0M3IPY5 | 264-433 | None |
| A0A6S7ICK8 | 262-417 | None |
| A0A6S7IGY5 | 243-398 | None |
| A0A7D9M251 | 18-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.