DPCstruct | MC47604
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 239 ± 39 aa |
| Standard deviation of domain lengths | 39.04 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A545VEH8 | 3-233 | SLPQPRRKPLNPGGSKEDQVRRELEETLLNISRRYVKKFSGPDPANTVVGFTNFTEVADGLSEVVDTVWRSGTPILQIPFLLKICGD… |
| X0B688 | 10-206 | LLLVTRRYVKKFGNPEPGDTVVGYARFGEVCRDLDSITNVLWKSGTPSLQIPFLLRLTSDFTRYVRSFPPAPKASFAILRKLDHCFA… |
| A0A2I0RJB1 | 25-266 | None |
| A0A1E3PS43 | 5-230 | None |
| A0A261Y6L4 | 7-189 | None |
| A0A4U0WS29 | 96-338 | None |
| A0A232LTR7 | 305-512 | None |
| A0A1E2YCZ3 | 23-255 | None |
| A0A4Y9YR17 | 323-576 | None |
| A0A238F1L8 | 1-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.