DPCstruct | MC476
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 217 ± 18 aa |
| Standard deviation of domain lengths | 17.62 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 20.65 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | PF02624- PF04738 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B0I7N3 | 1-201 | MKVSPLYIYRETHFPLQRVSHYLGDLAERYAEAKARATRLEPRATEVIEEMEHAIAGITEDQDRMEAIRFKRDFFNTRPSAQGRYER… |
| A0A3N0E4J6 | 1-256 | MATSITSNAPDFSQFRIAETRVVRGYGIDVTVLSRLNHAKTFSVVHTRLDREESLANEAAAISDALFTIIGTLSNSPSKPRPLGLRR… |
| A0A066Z1U2 | 1-217 | None |
| A0A2N0FPK6 | 4-230 | None |
| A0A318NQU5 | 251-477 | None |
| A0A3N0BSF4 | 1-227 | None |
| A0A7W9KDE1 | 2-188 | None |
| A0A438MF65 | 1-192 | None |
| A0A4R4SAD9 | 106-328 | None |
| A0A4Y9S6U1 | 1-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.