DPCstruct | MC47593
Metacluster Properties and Pfam Annotations
| Number of structural domains | 98 |
|---|---|
| Mean domain length (aa) | 91 ± 15 aa |
| Standard deviation of domain lengths | 14.81 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0349 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0U3F0 | 13-96 | PGQEPLKFHFPERNRIIAGLCQAVIVAEARLRSGSLITCERAMEEGRDVFAIPGNILDGKSAGCHHLIQEGAKLVTSGQDILDE |
| A0A2M8ERK1 | 242-330 | EYPYAMKAALHTFPQRNRIIAGLSKGIFVVEAPEKSGALITANFAVDYNRDVFALPGSIFSENSKGTNNLIKTGAAPVTSGEDILRL… |
| T0CR84 | 83-182 | None |
| D4IVN1 | 10-107 | None |
| A0A3T0K467 | 216-311 | None |
| K2Q0Y6 | 246-349 | None |
| A0A847AT59 | 14-110 | None |
| A0A756D3T6 | 205-292 | None |
| A0A7V8BDH4 | 2-62 | None |
| A0A1Y4FDJ3 | 135-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.