DPCstruct | MC47592
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 227 ± 31 aa |
| Standard deviation of domain lengths | 30.90 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 17.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0TYU4 | 2-213 | EQLAHNFRLTETFLNSLGTPQKSTASDSKLVWKDIDSVQVENFLQEYQVISEDKRMATINNLIEWLKENNHTINDWNIVLSSKGKIE… |
| A0A6G9YNE4 | 207-402 | PGIGVEPTGYPKDITRLRENTNAFRPLLDAASNKIELRSSIRNYYPAFVGIIEHQELLRVLQKLSWLEDDYFEPDLRWLNRLGPDKI… |
| A0A449G7M3 | 146-383 | None |
| A0A379ZH63 | 214-479 | None |
| A0A4R9F0G9 | 33-274 | None |
| A0A4R2ZHF3 | 656-859 | None |
| A0A6A7KPH0 | 13-173 | None |
| A0A1X3A6B1 | 290-553 | None |
| A0A645G3S9 | 6-223 | None |
| A0A645BPG9 | 11-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.