DPCstruct | MC47591
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 94 ± 18 aa |
| Standard deviation of domain lengths | 17.51 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 40.54 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0062- CL0158 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K3AAS0 | 16-98 | FGATVAALFAAFPKELVMAIAGIALFGTIGNSLAMALKDEGEREPALITFLVTASGLSLFGIGAAVWGLLAGAATSLLWRRTR |
| A0A376TH91 | 100-195 | AAAVAGIFYLIAGLFGSAITGMMAALPVSWIQMLAGLALLSTIGGSLYQALHNERERDAAVVAFLVTASGLTLVGIGSAFWGLIAGG… |
| A0A0H3APL3 | 526-647 | None |
| A0A3M3RYJ9 | 158-253 | None |
| A0A511V2Y5 | 95-213 | None |
| A0A812U0A6 | 922-1036 | None |
| A0A844VVR4 | 4-75 | None |
| A0A7W6K823 | 188-265 | None |
| S7XDY1 | 99-189 | None |
| A0A3S4I2F6 | 103-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.