DPCstruct | MC47584
Metacluster Properties and Pfam Annotations
| Number of structural domains | 73 |
|---|---|
| Mean domain length (aa) | 178 ± 33 aa |
| Standard deviation of domain lengths | 33.07 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 75.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4GZW5 | 1-188 | MSRDTTTPTDKTYTIGESFYPIAPCEFERYERSDVVPDIQFPFDIQPGTVSFTHEPPKKGWVRYMHPEGAQYFCLQHALFMVYTDAN… |
| X8J893 | 2-167 | IIHPEGLPYFHQDKLVTSDNLDDPHVKELVASAVALVCCMLRHMKDIQEDFKFHDEVELCVELKSTDYPPKFNYYIADHAKQTIFWA… |
| A0A166HBT8 | 2-171 | None |
| A0A5K1K4V5 | 44-229 | None |
| A0A165Y806 | 56-282 | None |
| A0A0D2P0W8 | 5-108 | None |
| A0A2H3D5Z6 | 95-273 | None |
| A0A2H3CZL1 | 1-169 | None |
| A0A1J8QNY3 | 175-346 | None |
| A0A369JDE7 | 24-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.