DPCstruct | MC4758
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 121 ± 10 aa |
| Standard deviation of domain lengths | 10.02 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G5FHX0 | 3-121 | NIILYLLTVIQEQYKTICWLLNFICRYIPLKQWAFDDSHSPKYHKFTTDRLPVIKPFIKQDWQFLLEYYLWKYGKTVRSVQRRNGKS… |
| G5FCS8 | 1-107 | MDNIILYLLTVIQEQYKTICWLLNFICRYIPLKQWAFDDSHSPKYHKFTTDRLPVIKPFIKQDWQFLLEYYLWKYGKTVRSVQRRNG… |
| A0A6C2U869 | 1-138 | None |
| A0A3S9T0B2 | 2-123 | None |
| A0A097AQC3 | 8-125 | None |
| A0A1M6MSE7 | 446-549 | None |
| R5KU21 | 3-120 | None |
| A0A1Y4S3Y7 | 48-173 | None |
| A0A660R0G9 | 1-136 | None |
| A0A3S9SXH8 | 1-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.