DPCstruct | MC47574
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 160 ± 17 aa |
| Standard deviation of domain lengths | 17.41 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 41.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0032 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H3CAJ5 | 211-353 | GEARPGSEEGHEHFGYMDGISQPAVKGFTQSPLPGQLAVDAGEILLAEDGDSTTRPPWAKDGSFLVFRQMEQLVPEFNKFLLDNPIS… |
| L8WIQ1 | 462-627 | HEHFGFLDGISQPSIRGIEHPLPGQLQVDPGVIVMGYPGDPVSKWDRASWTKGGTMMVFRKLEQSVLEFKKYCRDNGQRWKEFVPGG… |
| A0A146ICZ1 | 606-742 | None |
| A0A0A1UJ94 | 260-437 | None |
| A0A0D0AES1 | 239-405 | None |
| A0A0C9VW61 | 1-172 | None |
| A0A0C9VID8 | 3-172 | None |
| A0A4Y9ZYI4 | 199-386 | None |
| A0A0H2RS85 | 378-526 | None |
| M5CCX5 | 77-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.