DPCstruct | MC4757
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 100 ± 8 aa |
| Standard deviation of domain lengths | 8.23 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C3TH49 | 93-179 | GTEGGLYRTDDGGITFKKVSYINHEVKIESGQLITPFDFPNMPYKKDGIFKMLVGQGSDGDYNGNSSILYQSKNQGETWEYVKEVKG |
| G5F7I3 | 1-93 | MALSHNGGDEAELYRTEDGGRTTTRVELPYSVMEEKPNPDEPFDFPSMPYEEDGTLIMLIGQGADGDYHGGSKGLYQSTDQGKTWGF… |
| A0A242LGK0 | 43-137 | None |
| A0A0C7QIU1 | 1-106 | None |
| A0A4Y4G104 | 97-201 | None |
| A0A1H9A5U3 | 263-370 | None |
| A0A0U1KNE3 | 337-422 | None |
| A0A1I1FPU0 | 408-518 | None |
| A0A174XSB6 | 716-818 | None |
| A0A4Q2BPK2 | 381-486 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.