DPCstruct | MC47565
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 207 ± 22 aa |
| Standard deviation of domain lengths | 22.23 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01024 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K0MNM0 | 468-658 | EKAFEDIKSAVKFTADFYKDVFEHYGDKAEKIAQSMAKEAKNKKLTTPQNAEKLYNKHKSNLDKKIKAADRAIIAEHIKSLTLKSSS… |
| A0A7U9GB26 | 29-250 | TNEQKHANDALNALLKEKENIRSQLADINQKIAEEKRKRDEINMVKDAIKLTSDFYRTIYDEFGKQASELAKELASVSQGKQIKSVD… |
| A0A2X3KF24 | 272-508 | None |
| A0A3Q9D568 | 71-303 | None |
| A0A1H1F2Z1 | 219-427 | None |
| A0A2N8ERE8 | 279-488 | None |
| A0A080J0N9 | 250-462 | None |
| A0A2S4S368 | 275-463 | None |
| A0A6I7D5W1 | 99-326 | None |
| A0A7Y6AR86 | 362-579 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.