DPCstruct | MC47564
Metacluster Properties and Pfam Annotations
| Number of structural domains | 356 |
|---|---|
| Mean domain length (aa) | 136 ± 20 aa |
| Standard deviation of domain lengths | 19.50 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 92.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 20.43 |
| Pfam Score | 98.84 |
| Assigned Pfam label(s) | PF00384- PF09326 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1M5A1 | 15-144 | APRDGHAIAEGLASGELSALYLHQCDPLRELPDRELWERALTAASTVVAHASFMTEAIAEHADVVFPAEAYPEKEGTVVHPDGRLQR… |
| A0A6D0M1H0 | 3-96 | ELVIVQDIFMTKTAAAADVILPSTSWGEHEGVYTAADRGFQRFFKAVEPKWDLKTDWQIISEIATRMGYPMHYNNTQEIWDELRSLC… |
| A0A0B8P3X0 | 34-168 | None |
| A0A7C5L3H1 | 2-209 | None |
| A0A0B8P3V6 | 442-620 | None |
| A0A0T9NLK5 | 2-142 | None |
| A0A3M1I7G5 | 133-275 | None |
| A0A5A9GGA0 | 446-596 | None |
| A0A538QPE2 | 174-302 | None |
| A0A1F7TPI8 | 38-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.