DPCstruct | MC47562
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1794 |
|---|---|
| Mean domain length (aa) | 142 ± 22 aa |
| Standard deviation of domain lengths | 21.50 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 20.12 |
| Pfam Score | 97.32 |
| Assigned Pfam label(s) | PF02666- CL0504- CL0105- PF19425 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0TGJ0 | 11-142 | AFTFLRHRFPLIGAHDYGEEQARFGGGRGHQGQDVFAACGTPVVAARGGVVEFAEYQSAAGNYLVIDGARTDVDSAYMHLREAALVV… |
| A0A7D8AMC0 | 14-155 | DLIAPVSGKVVSIDKVPDEAFAEKIVGDGVAIIPTGSELVAPCDGTIGKIFKTNHAFSLETKEGVEIFVHFGINTLNLNGKGFTRVA… |
| R5MBK7 | 750-891 | None |
| R5MVK0 | 13-121 | None |
| A0A7Y4Y4H4 | 233-379 | None |
| A0A2G4IJE7 | 5-90 | None |
| A0A6L3ET28 | 8-142 | None |
| A0A2N2WME8 | 28-174 | None |
| A0A538R1D6 | 19-148 | None |
| A0A7C3U469 | 34-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.