DPCstruct | MC47559
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 67 ± 8 aa |
| Standard deviation of domain lengths | 8.10 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 40.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5Q5G057 | 40-97 | ESLLMQCRHCIRYSLGYCVKRGGKKPSWREPLFLQLGDGRRFRLEFACNECQMNLYSE |
| A0A645EYQ7 | 15-74 | KAVEGVPLMFTKHCIKYEMGWCPREGKKSEMKEPFRLKNNDQEYELRFDCKKCEMHVFAA |
| A0A0H3U7H4 | 199-275 | None |
| A0A378B432 | 138-208 | None |
| A0A0S2SLB3 | 109-173 | None |
| A0A3M6R2I6 | 298-373 | None |
| R5BK72 | 50-124 | None |
| A0A380C9K0 | 312-369 | None |
| U2J9W5 | 160-216 | None |
| A0A3R6J3U0 | 158-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.