DPCstruct | MC47557
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 98 ± 11 aa |
| Standard deviation of domain lengths | 10.88 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 44.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N9XQW3 | 1-114 | MHVIANSRWVTWRPPRFMPDDVDGWVLFDVAARTASGAVGGGVSDLGDIVMVSSVCDARDRGVLHARSMIARLSAHGVWWVDGVRPA… |
| A0A7X7JTV5 | 62-165 | TWVTRRPPVWRSAPFEDGWGRKVEDRVRARTEAGLLPESVVTATGLALTDEYQRGIEAGVLVSVGALRELSRDGIILDDGRFVPADV… |
| A0A1D2ILE0 | 2-96 | None |
| A0A1L7NP37 | 1-107 | None |
| A0A4R3ZNL3 | 59-154 | None |
| A0A6I2IZ86 | 6-87 | None |
| A0A031LIQ3 | 37-141 | None |
| A0A1T4NAY8 | 190-271 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.