DPCstruct | MC47550
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 128 ± 25 aa |
| Standard deviation of domain lengths | 24.67 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 75.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E0MH14 | 22-130 | AGGEGDQIKPSAKVPMPENFVAMILALKREPWPTSKYLESLSPEKRSEELKRADRRSKLDDDLENLQKDVRDGIDNDGYYLVDESYL… |
| A2Z7B8 | 14-146 | EATAPEEEKKKMMVRLPQAEVDWILAQERERACDPEDFAGLRTIDRRESVMAEEEIEETRAILLATAALRAAAGDAFAEYQAEVRAA… |
| A0A0D9XRB4 | 2-111 | None |
| M8BXJ1 | 1-132 | None |
| A3CCR1 | 82-166 | None |
| A0A835E7A5 | 44-202 | None |
| A0A835A0F4 | 336-481 | None |
| A0A0D9XQF1 | 21-144 | None |
| A0A0D9XTY7 | 45-186 | None |
| J3LXN6 | 230-347 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.