DPCstruct | MC4754
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 103 ± 12 aa |
| Standard deviation of domain lengths | 11.75 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 23.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1FAY3 | 24-129 | LVESIRITQVMDCLADPERIRAVAVPSTDIGPALPYLASLLPQAGYNHEAGILTLVHHGRLLTVYRQLVTLAKALDEQDAEDVLEWL… |
| A0A1W9U9K7 | 1-103 | MLLRDVKPEVVLPPCDYGRETVNVIGRFEKDLSPVMPYLNATQSKALYHRAANILRFRFEGHQVTLQPHEMAVSGLADADEAVEALA… |
| A0A524LIX6 | 11-110 | None |
| A0A1G3QZ42 | 1-114 | None |
| A0A0S7YIY0 | 96-203 | None |
| A0A6I1ZTQ0 | 49-159 | None |
| A0A2N2GT37 | 1-117 | None |
| A0A7W0EU43 | 3-112 | None |
| A0A7V5P0S9 | 116-218 | None |
| U5RYP8 | 1-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.