DPCstruct | MC47535
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 125 ± 22 aa |
| Standard deviation of domain lengths | 21.90 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 31.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20173 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813UNH9 | 20-140 | KLRVENLMDEIDILLIKKTEKLNNESEEFIKKKFNELSSLISIKISEKERLNIVRAVGLEKGSWFKCKNGHPYVIGECGGPVEKAKC… |
| A0A177UGP2 | 365-494 | SELERLREYWEKALSSATLGAAFQDQLNDIVSRRLADVEHFIKQRQARKAELKMIVETLIRFNVDFAYGGHFYRCPNGHVFTIGDCG… |
| A0A2I1E534 | 661-762 | None |
| A0A813BNT1 | 426-553 | None |
| A0A2P8ZD95 | 21-126 | None |
| A0A812RU66 | 205-358 | None |
| B8C4V1 | 134-238 | None |
| A0A6P8ZH84 | 4-89 | None |
| A0A3M7ASZ2 | 391-518 | None |
| A0A1S3R0Z2 | 7-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.