DPCstruct | MC47532
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 270 ± 37 aa |
| Standard deviation of domain lengths | 37.04 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 17.20 |
| Pfam Score | 80.00 |
| Assigned Pfam label(s) | PF04003- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813NJZ1 | 8-268 | RLSCSNLIESKNTCTMYKFKDNIHKCIQDKNIDNRDVIVECMRNLSGILPSKLLSGLLSKAIELNDSDLCSLLVDNVQLLEESHAVE… |
| D8U5V6 | 444-741 | CNSLIEQLSSAAAADTPPSQSLLDSVVSYIAGRRQHGMAVPPQLLSLTARGLAAARQWSQLGSFLNHVPRGGLSGCSDVLVLAAAAQ… |
| A0A6J1KN19 | 8-253 | None |
| A0A4P1RU70 | 111-369 | None |
| L1JVY4 | 408-696 | None |
| A0A4Y7L2W9 | 811-1100 | None |
| A0A388L7F9 | 741-1038 | None |
| A0A4S4DRH3 | 94-395 | None |
| A0A803XSA3 | 463-779 | None |
| A0A1S0TRE4 | 21-255 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.