DPCstruct | MC47531
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 177 ± 20 aa |
| Standard deviation of domain lengths | 19.62 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J7PU60 | 222-396 | SSSIENLLNLPRNFSRQSSRFELPLDSRLLNTMTPMQYIQRYICISSGRRQLYNTVFNRHKEKVEEDETERRIVGQNVAVALGEIMG… |
| A0A813MQR6 | 22-190 | DLKANNNIGRLALSKNICRFELPIDMKLFETMTPANYLERYCKVNDRRKTLYKRVFDKYKIKNEKEDFVDLKTFEECLIEVHMKSIN… |
| F6QXI6 | 284-478 | None |
| A0A4S2LRP8 | 73-249 | None |
| A0A811V4E0 | 1-163 | None |
| A0A8B6C7N8 | 544-733 | None |
| A0A3P7P5I5 | 12-179 | None |
| A0A815LUV1 | 96-271 | None |
| A0A819KVM0 | 31-206 | None |
| A0A6P8J9H7 | 39-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.