DPCstruct | MC4753
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 107 ± 12 aa |
| Standard deviation of domain lengths | 11.51 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03334 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G7NST2 | 4-106 | IAEILAGLAAMTGAVFVFSAALGLVRMPDVYLRMHAATKAGTLGSGLVLVGVAVWSGEPGVVLRALAAILFLIMTAPVAAHLLGRAA… |
| A9FPT2 | 2-103 | ILAIVEGALLVVGCIFMLLAAVGILRMPDLFTRLQVTSKASVFGMTCIISASALHFYDPAVTTRAIVIIAFVALTMPVATHLLARAG… |
| A0A6B8JT48 | 2-88 | None |
| A0A843CXX5 | 2-99 | None |
| A0A2H0PNE6 | 3-90 | None |
| A0A1Q3Q4L5 | 2-90 | None |
| A0A1A0J8W2 | 2-131 | None |
| A0A7C1CRW9 | 1-107 | None |
| A0A3N6HJD4 | 4-115 | None |
| A0A2S5X8R0 | 1-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.