DPCstruct | MC4752
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 118 ± 7 aa |
| Standard deviation of domain lengths | 7.38 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 38.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A9FFH6 | 8-123 | SPWPFEVLLGVAHPMRECWVLAGFVPEGKQEEASLAALRKELGFDPAARSHELDASSNTAKKSPKRVLDRITGGEHEREARCWTEPD… |
| A0A084SRH5 | 66-185 | EQARNDRSWPFQVIIGLAEPKRECWVLAGFEPRTADEADQLEKQRKRLSFHPVRDAHQLTAREHGAKKDAKVALDALTLGDKERERA… |
| A0A150PN01 | 23-140 | None |
| A0A7Y4UFR9 | 85-212 | None |
| A0A4P2QYI7 | 1-100 | None |
| A0A845XCD8 | 59-171 | None |
| A0A539D690 | 28-149 | None |
| A0A832E3G0 | 100-221 | None |
| A0A6P0RF32 | 7-126 | None |
| A0A517Z7J6 | 1-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.