DPCstruct | MC47517
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 216 ± 38 aa |
| Standard deviation of domain lengths | 37.63 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W4HPL8 | 6-240 | NNVEIILRQQLEKGISGEVLNSFDIETYTYSKEDMEAVIPVAEKIILSQGYIPPSNKAFSEKVQMIFKRKIDFNLSSKYLYLNFNEK… |
| A0A1N6U2M9 | 1-218 | MKNIFLALLYSFVLSCTGQESKLKLQNIKEINSLKDKPYNITNEGDGTKSNYDDLSPEFINKAKKVLEQRKFQFPDENTFNQKILDI… |
| A0A2N3I0G9 | 22-254 | None |
| A0A2V2ZMX9 | 1-287 | None |
| A0A1H8D3W5 | 44-292 | None |
| A0A7K1X8F3 | 4-222 | None |
| A0A0C2VJG9 | 4-195 | None |
| U2C7J2 | 4-163 | None |
| A0A250FNT9 | 2-213 | None |
| A0A1I0D6W4 | 16-303 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.