DPCstruct | MC47515
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 86 ± 7 aa |
| Standard deviation of domain lengths | 6.71 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J0CBX4 | 1-76 | MKNTIRSTFDAPIQAASYIGALNSDENYKFQVQNGLIVIGYTSGEPASVYEMNSQILNMYWKQWLRRLQQYYVVED |
| A0A6D0ZKG8 | 147-229 | IMDYKNSRKVKKWGQIENYRMQIAAYALAHNQMFGTNIERGVIFICVRKDPNNLQYQEFVIEGQDFKDAVNMWIERVEQYYIL |
| A0A7R8CJ44 | 305-389 | None |
| T1JWZ8 | 275-359 | None |
| A0A7R9AR32 | 5-85 | None |
| A0A154PHK9 | 35-117 | None |
| A0A6S7G3Y2 | 199-284 | None |
| A0A3Q0J722 | 195-278 | None |
| A0A401S8F0 | 55-133 | None |
| A0A8B6D0U3 | 279-365 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.