DPCstruct | MC47514
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 77 ± 5 aa |
| Standard deviation of domain lengths | 5.49 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 70.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 53.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0466 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J0C8Q3 | 1-78 | MVDLGGYIIILMNHNGKVKLYGSPADNADNLEVGDEILEVNGRTLENATHSEVIQHIHQCIKSRTICLRVRRRSGNKM |
| A0A821SGS8 | 24-102 | SVDLEGYVIIVVQTKDNKIKLYGSPSAGNFDNLELADEIMDVNETRLEDMSRTEVLSHIHECISSCVIKLRVKRRSETK |
| A0A6P8ZL88 | 27-99 | None |
| A0A1B0G838 | 153-226 | None |
| A0A182K641 | 22-112 | None |
| A0A443SSY4 | 1-69 | None |
| B0W6S4 | 19-95 | None |
| A0A2A2LFB8 | 32-103 | None |
| A0A2A2L713 | 31-111 | None |
| E2QD98 | 33-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.